An
Email with the Subject "[Bulk?]UPS notify" was
received in one of Scamdex's honeypot email accounts on Fri, 23 Mar 2012 07:11:07 -0700
and has been classified as a Generic Scam Email.
The sender shows as "Cassian Franey" <LucyJoshi@ups.com>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
contactclaimmaildeliverypackageach[bulk?]dear
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
EEEEEstdClass Object
(
[return-path:] =>
[envelope-to:] => mc_mxw@o7e.net
[delivery-date:] => Fri, 23 Mar 2012 07:11:07 -0700
[received:] => Array
(
[0] => from c2mds.mailcentro.com ([208.67.179.143])by lester.newsblaze.com with esmtp (Exim 4.69)(envelope-from )id 1SB5Cp-0002nu-QIfor mc_mxw@o7e.net; Fri, 23 Mar 2012 07:11:07 -0700
[1] => from ups.com (pool-2M-ind-bb.wow.lk [122.255.12.26] (may be forged))by c2mds.mailcentro.com (8.13.8(MC-AXH/MJD-001)/8.13.8.axh-mjd) with SMTP id q2NEAu48009028for ; Fri, 23 Mar 2012 07:10:58 -0700
[2] => from mtu67.syds.piswix.net ([Fri, 23 Mar 2012 15:06:28 +0100])by webmail.halftomorrow.com with NNFMP; Fri, 23 Mar 2012 15:06:28 +0100
[3] => from [62.207.63.196] by mx03.listsystemsf.net with QMQP; Fri, 23 Mar 2012 14:48:51 +0100
)
[x-mc-sender:] => LucyJoshi@ups.com
[x-mc-ipaddr:] => pool-2M-ind-bb.wow.lk [122.255.12.26] (may be forged)
[message-id:] => <0B682420.0E8801FF@ups.com>
[date:] => Fri, 23 Mar 2012 14:40:38 +0100
[reply-to:] => "Sheona Fogleman"
[from:] => "Cassian Franey"
[user-agent:] => Mozilla/5.0 (Windows; U; Windows NT 6.0; de; rv:1.8.1.18) Gecko/20081105 Thunderbird/2.0.0.18
[x-accept-language:] => en-us
[mime-version:] => 1.0
[to:] =>
[subject:] => [Bulk?]UPS notify
[content-type:] => multipart/mixed;boundary="------------664151060823358254111613"
[x-mc-filter:] => 7.6.9
[x-mc-filter-antivirus:] => Scanned for virus - Status 0
[x-mc-deliveryid:] => 144
[x-mc-ctfilter:] => CT RefID = str=0001.0A010203.4F6C5462.0010,ss=3,sh,fgs=0 - Class:Bulk - Virus Threat:Unknown - Phishing Threat:Low
[x-mc-filterskip:] => 0
[x-mc-spamscore:] => 40 T 49
[x-spam-status:] => No, score=3.4
[x-spam-score:] => 34
[x-spam-bar:] => +++
[x-ham-report:] => Spam detection software, running on the system "lester.newsblaze.com", hasidentified this incoming email as possible spam. The original messagehas been attached to this so you can view it (if it isn't spam) or labelsimilar future email. If you have any questions, seethe administrator of that system for details.Content preview: Dear mxw@uniplexmail.com, hereby we notify you that deliveryat your address, tracking ID #724316, has FAILED to be delivered at the destinationdue to an address mismatch. To claim your package print out the attacheddocument and turn to any UPS office near you. [...] Content analysis details: (3.4 points, 4.0 required)pts rule name description---- ---------------------- --------------------------------------------------0.0 TVD_RCVD_SPACE_BRACKET TVD_RCVD_SPACE_BRACKET0.9 SPF_FAIL SPF: sender does not match SPF record (fail)[SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=lucyjoshi%40ups.com;ip=208.67.179.143;r=lester.newsblaze.com]0.0 UNPARSEABLE_RELAY Informational: message has unparseable relay lines0.7 HTML_IMAGE_ONLY_20 BODY: HTML: images with 1600-2000 bytes of words0.0 HTML_MESSAGE BODY: HTML included in message1.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts0.6 HTML_MIME_NO_HTML_TAG HTML-only message, but there is no HTML tag0.0 T_REMOTE_IMAGE Message contains an external image
[x-spam-flag:] => NO
)
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
Dear mxw@uniplexmail.com,
hereby we notify you that delivery at your address, tracking
ID #724316, has FAILED to be delivered at the destination
due to an address mismatch. To claim your package
print out the attached document and turn to any UPS office
near you.
Feel free to contact us with any further
questions.
UPS World Headquarters
55 Glenlake Parkway NE
Atlanta , GA 30328
United States
Tel.: 1-800-PICK-UPS