An
Email with the Subject "Fw:" was
received in one of Scamdex's honeypot email accounts on Mon, 15 Dec 2008 03:09:23 -0800
and has been classified as a Generic Scam Email.
The sender shows as Emily Larocque <larocqueedora@yahoo.ca>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
africaafrican atm natm atmnexpresscontactdrawsafedepositservicefund transferpaiddeliverypackagemailusddollarfedexexpressdispatchingde... willnnwilln will nwill securityyahoo!(0114)(twenty thousand united s... mr. john mike master card of master card with master card inside mr. david mark master card innmasterncard inside, master card withdrawingnmr. john mike
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
EEEEEstdClass Object
(
[return-path:] =>
[envelope-to:] => scam@scamdex.com
[delivery-date:] => Mon, 15 Dec 2008 03:09:23 -0800
[received:] => Array
(
[0] => from n60a.bullet.mail.sp1.yahoo.com ([98.136.45.7])by gogol.o7e.net with smtp (Exim 4.69)(envelope-from )id 1LCBKE-00080R-Idfor scam@scamdex.com; Mon, 15 Dec 2008 03:09:23 -0800
[1] => from [69.147.84.144] by n60.bullet.mail.sp1.yahoo.com with NNFMP; 15 Dec 2008 11:08:20 -0000
[2] => from [67.195.9.81] by t6.bullet.mail.sp1.yahoo.com with NNFMP; 15 Dec 2008 11:08:20 -0000
[3] => from [67.195.9.100] by t1.bullet.mail.gq1.yahoo.com with NNFMP; 15 Dec 2008 11:08:20 -0000
[4] => from [127.0.0.1] by omp104.mail.gq1.yahoo.com with NNFMP; 15 Dec 2008 11:08:20 -0000
[5] => (qmail 46316 invoked by uid 60001); 15 Dec 2008 11:08:20 -0000
[6] => from [70.76.74.175] by web111314.mail.gq1.yahoo.com via HTTP; Mon, 15 Dec 2008 03:08:19 PST
)
[x-yahoo-newman-property:] => ymail-5
[x-yahoo-newman-id:] => 383002.38832.bm@omp104.mail.gq1.yahoo.com
[domainkey-signature:] => a=rsa-sha1; q=dns; c=nofws; s=s1024; d=yahoo.ca; h=X-YMail-OSG:Received:X-Mailer:Date:From:Reply-To:Subject:To:MIME-Version:Content-Type:Message-ID; b=GITGcWYAbbwkqDdDiGyveYvyYeNrgVDXaG3wDt/XoHPH+VMU08/xbR+BuvxjocXqaEQrd+lSM32BODzQ0YZlFcCR0XvX8y3EPbpOG2QUKKFZzGRyd2cUWX+amhxG2X9Ll69Jr3UgXzPA1X0XdGihkx4iBag8PLdM/XIcgAZZeqc=;
[x-ymail-osg:] => 7ERbhRMVM1lAMKGZqlA6DcJXiv9lyJeApMIcm9XXZ4hEpg_fjFIwFi21MYkf8xWgb9osR6seexUetjBgF.RutsdWC5rRzJTg8k75XkStznKEA4nuVK0dl9mz_4fE8vtcJa9ImaIqQdH2VlQmi3dA8F1dtshyAEOndV4BK1kPsEE9YqnairN0a4NA9K0k
[x-mailer:] => Array
(
[0] => YahooMailWebService/0.7.260.1
[1] => <295028.46307.qm@web111314.mail.gq1.yahoo.com>
)
[date:] => Mon, 15 Dec 2008 03:08:19 -0800 (PST)
[from:] => Emily Larocque
[reply-to:] => larocqueedora@yahoo.ca
[subject:] => Fw:
[to:] => Scam@scamdex.com
[mime-version:] => 1.0
[content-type:] => multipart/alternative; boundary="0-770377715-1229339299=:46307"
[x-spam-status:] => No, score=-4.7
[x-spam-score:] => -46
[x-spam-bar:] => ----
[x-spam-flag:] => NO
[message-id:] => REIDs3x1239839813.M205110P32690V-S3X
[x-scamdex-scores:] => S:55 P:45 A:49 L:45 E:50 G:44
[x-scamdex-classtype:] => S
[x-scamdex-classscore:] => 55
[x-scamdex-totscore:] => 288
[x-scamdex-kw:] => Bless,access,africa,bank,card,contact,dollars,fund,inc.,nigeria,package,paid,response,safe,sent,service,share
[x-scamdex-em:] => bm@omp104.mail.gq,fedexexpressdispatchingdept@live.com,igrc@gil.com.au,larocqueedora@yahoo.ca
[x-scamdex-dir:] => B
[x-scamdex-id:] => B1239839813.M205110P32690V
[x-scamdex-copyright:] => This Email is Copyright Scamdex.com 2009, Reproduction Prohibited
)
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
--- On Sat, 12/13/08, Mr. John Mike <igrc@gil.com.au> wrote:
Scam letter
--- On Sat, 12/13/08, Mr. John Mike <igrc@gil.com.au> wrote:
From: Mr. John Mike <igrc@gil.com.au> Subject: To: Received: Saturday, December 13, 2008, 8:44 PM
Dear Friend,
Good day,
I just want to inform you that I have deposited your ATM MASTER CARD of USD
$800, 000. 00 United state dollars to the FedEx Delivery services here in West
Africa, due to I have waited enough to hear from you so that your funds will
be Transferred through CENTRAL BANK OF AFRICA (BOA) here, but because of the
late Response I now decide to deposit the ATM MASTER CARD with the FedEx
delivery services with your previous information as you Listed it before.
I have paid to them their delivery charges & insurance coverage fee, the
only
Fee to be paid again is their security safe keeping fee of $185 dollars only.
I Would have paid that but they said no because they don't know when you
will
Contact them and in case of demurrage.
I will be traveling to IRAQ to see my boss and I will not come back till next
Month, Therefore I will advise you to contact the FedEx shipment officer with
His contact information as listed below for the avoidance of increase of their
Security safe keeping fee.
Note that I packaged the ATM MASTER CARD inside a magazine where nobody will
Notice the content, I also told the shipment officer Mr. David Mark that it is
an Ordinary African magazine I want to deliver to my friend abroad to avoid
Further delay unless you delay to send their security safe keeping fee.
Below is the shipment officer contact information including his email address.
With the parcel reference number, note that without you indicating your parcel
Number as listed below the FedEx delivery services will not listen to you they
Will be imagining if you want to steal another personʼs parcel.
Attention: Mr. David Mark Shipment Officer of FedEx Express delivery services
Nigeria.
E-mail: fedexexpressdispatchingdept@live.com
Parcel Number: Eg2272
ATM Pin Code Number: 0114
Also below is the information they need to deliver the ATM MASTER CARD in form
Of African Magazine to your address, this is to avoid wrong delivery as I
Already gave them your delivery address but you have to re-confirm it to them
Ok.
Full name...............
Home address............
Country.................
Telephone...............
Please make sure the information is complete as they promised that once they
Receive their security safe keeping fee within 2 to 3 working days the
magazine Will arrived your door step according to the shipment officer.
Once again, the FedEx delivery services do not know the content of the parcel,
I Registered it as an African magazine they don't know it contains ATM
MASTER
CARD Inside, this is to avoid them delaying the delivery and besides I
don't
want you
To lose your inheritance funds.
Your ATM MASTER CARD withdrawing access pin code number is (0114) take note,
Once you receive the card you take it to any cash point around your area and
Slotting it and enter the pin code for withdrawal, the amount you are to
Withdrew per day is USD$20,000.00. (Twenty thousand United State dollars) each
Day.
Remain blessed and enjoy your funds.
Thanks.
Mr. John Mike
_________________________________________________________
This mail sent using iTEL Webmail - www.itel.net
Yahoo!
Canada Toolbar : Search from anywhere on
the web and bookmark your favourite sites. Download it now!