An
Email with the Subject "Fw: YOUR BANK DRAFT US$850,000.00" was
received in one of Scamdex's honeypot email accounts on Mon, 06 Apr 2009 09:30:20 -0700
and has been classified as a Advance Fee Fraud/419 Scam Email.
The sender shows as Arthur Luna <aluna831@sbcglobal.net>.
The email address was probably spoofed. Do not reply to or contact any persons or organizations referenced in
this email, or follow any URLs as you may expose yourself to scammers and, at the very least, you will be
added to their email address lists for spam purposes.
Scam TagCloud
africa thousand silverforeignpresidentbankgooglecontactnationalagentresident thousandglobaldepositeddepositcouriertransactionforeignerservicefund transferpaidpackagedeliverymailbank dollar your bank certified bank the bank r_brown1013@msn.com will googlem(eight hundred and fifty ...
NO CHART DATA - EMAIL HAS NOT YET BEEN ANALYSED
Scam Email Headers
This a (redacted) view of the raw email headers of this scam email.
Personally Identifiable Information (PII) has been suppressed, but can be
supplied as received to appropriate investigating or law enforcement agencies on request.
Domain Names used for collecting scam email ("Honeypot email accounts") have been obscured and replaced with the token 'HUN1P0T'
Community Action - SPAM/non-Scam Report
Occasionally, incorrectly categorized emails get into the Scamdex Scam Email Database and need to be removed. If this
email has Personally Identifiable Information (PII), or is, in your opinion, from a bona-fide entity, let us know.
Scamdex will, as soon as is practicable, take-down any emails that in our opinion should not
be in our database. Note that ALL emails in the Scamdex Scam Email Database were received as Unsolicited Commercial Email, aka UCE or
SPAM, via unpublished 'Honeypot' email addresses.
--- On Mon, 4/6/09, Mrs.Rita Brown <r_brown1013@msn.com> wrote:
--- On Mon, 4/6/09, Mrs.Rita Brown <r_brown1013@msn.com> wrote:
From: Mrs.Rita Brown <r_brown1013@msn.com> Subject: YOUR BANK DRAFT US$850,000.00 To: Date: Monday, April 6, 2009, 11:28 AM
Greetings!!!
I write to inform you that your contact was found among the list of foreigners that have been scammed by Fraudsters. It might interest you to know that we have signed an agreement with the UNITED STATES GOVERNMENT during our first meeting this year with our PRESIDENT and the FBI to fight against corruption by returning all contract funds that has been stolen, paying the people that had an unfinished transaction or International Fund Transfer that failed due to Government problems and also compensate scam victims.
Based on the above, a certified Bank Draft worth US$850,000.00 (EIGHT HUNDRED AND FIFTY THOUSAND U.S DOLLARS) has been issued in your name as compensation. I have deposited the Bank Draft with FEDEX COURIER SERVICE, West Africa. I traveled out of the country for a 3 Months Course and I will not be back until completion of my 3 months course. What you have to do now is to contact the FEDEX COURIER SERVICE immediately
to know when they will deliver your package to you because of the expiry date of deposit.
For your information, I have paid for the delivery Charge of the Bank Draft. You have to contact the Agent of FEDEX COURIER SERVICE now for the delivery of your Bank Draft with information below:
Contact Agent: Silver Idem Email:idemsilver@googlemail.com
Reconfirm the below information to the agent:
1. Full Names: 2. Residential Address: 3. Phone Number:
Request for the tracking number of the package to enable you track and know when it will get to your address. Contact the Agent immediately you receive this mail to avoid any further delay
